Calmodulin bovine, recombinant, expressed in E. coli, lyophilized powder, >=98% (SDS-PAGE)

Application

Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease Glu-C proteolysis and deamidation studies.

Biochem/physiol Actions

Ca2+ binding protein that is required for activation of cyclic nucleotide-dependent phosphodiesterase. It is also a cofactor/activator of nitric oxide synthase, calcineurin, and many kinases including ATPase, myosin light chain kinase, and CAM kinase I, II, and III. It mediates ryanodine receptor activation by cyclic ADP-ribose and is involved in intracellular Ca2+ homeostasis.

Calmodulin from bovine undergoes conformational changes upon calcium binding. It binds to sphingosylphosphorylcholine and inhibit calcineurin and phosphodiesterase enzymes.

General description

Calmodulin from bovine takes up a dumb-bell-structure. Two calciumbinding EF hand loops, antiparallel ?-sheet and three ?-helices comprises a lobe. It has a central helix connecting the lobes. Calmodulin can bind four calcium molecules in a cooperative interaction pattern.

Physical properties

Sequence:MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Preparation Note

Produced using animal component-free materials.

No detailed specifications are available for this product.

There are no downloads for this product.

Code Description Quality Level Manufacturer Composition Form Assay Price Quantity
3589909 Calmodulin bovine, recombinant, expressed in E. coli, lyophilized powder, >=98% (SDS-PAGE) 200 SIGMA-ALDRICH Protein, ≥85% lyophilized powder ≥98% (SDS-PAGE)
Click Add to Quote for price and delivery
-
+
3589910 Calmodulin bovine, recombinant, expressed in E. coli, lyophilized powder, >=98% (SDS-PAGE) 200 SIGMA-ALDRICH Protein, ≥85% lyophilized powder ≥98% (SDS-PAGE)
Click Add to Quote for price and delivery
-
+
3589911 Calmodulin bovine, recombinant, expressed in E. coli, lyophilized powder, >=98% (SDS-PAGE) 200 SIGMA-ALDRICH Protein, ≥85% lyophilized powder ≥98% (SDS-PAGE)
Click Add to Quote for price and delivery
-
+
3589912 Calmodulin bovine, recombinant, expressed in E. coli, lyophilized powder, >=98% (SDS-PAGE) 200 SIGMA-ALDRICH Protein, ≥85% lyophilized powder ≥98% (SDS-PAGE)
Click Add to Quote for price and delivery
-
+