SILU(TM)LITE CXCL8

SILU(TM)LITE CXCL8

Stock Code: 3587251
Manufacturer Part No: MSST0058-50UG
Order Now for 7 day delivery
Click Add to Quote for price and delivery
Quantity: - +

Biochem/physiol Actions


Interleukin-8 (IL-8) is a member of the CXC chemokine subfamily and is produced by blood cells and many types of tissues. The measurement of IL-8 in voided urinary samples may have utility for urine-based detection of bladder cancer. Urinary IL-8 was a strong biomarker of stress under intensive and prolonged demands, both acutely and over time. IL-8 and cathepsin B levels were significantly elevated in melanoma patients, and more importantly, the combination of IL-8 and cathepsin B were also studied as a prognosis marker for melanoma mortality.


General description


SILu™Lite IL8 is a recombinant human protein expressed in human 293 cells. It is a mixture of the 3 main CXCL8 isoforms with the molecular weights, amino acid number and relative abundance as described in Table 1 of the product datasheet. SILu™Lite IL8 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.


Legal Information


SILu is a trademark of Sigma-Aldrich Co. LLC


Physical form


Supplied as a lyophilized powder containing phosphate buffered saline.


Sequence


EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Quality Level200
ManufacturerSIGMA-ALDRICH
Storage Temp.−20°C
Suitabilitysuitable for mass spectrometry (internal calibrator)
Formlyophilized powder
Assay≥95% (SDS-PAGE)

There are no downloads for this product.