SILU(TM)LITE TIMP2 METALLOPROTEINASE

SILU(TM)LITE TIMP2 METALLOPROTEINASE

Stock Code: 3587240
Manufacturer Part No: MSST0046-50UG
Order Now for 7 day delivery
Click Add to Quote for price and delivery
Quantity: - +

Biochem/physiol Actions


While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance.


General description


SILu™Lite TIMP2 is a recombinant human protein expressed in human 293 cells. It consists of 194 amino acids, with a calculated molecular mass of 21.7 kDa. SILu™Lite TIMP2 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.


Legal Information


SILu is a trademark of Sigma-Aldrich Co. LLC


Physical form


Supplied as a lyophilized powder containing phosphate buffered saline.


Sequence


CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Quality Level200
ManufacturerSIGMA-ALDRICH
Storage Temp.−20°C
Suitabilitysuitable for mass spectrometry (internal calibrator)
Formlyophilized powder
Assay≥98% (SDS-PAGE)

There are no downloads for this product.