SILU(TM)PROT TIMP1 METALLOPROTEINASE

SILU(TM)PROT TIMP1 METALLOPROTEINASE

Stock Code: 3587237
Manufacturer Part No: MSST0043-10UG
Order Now for 7 day delivery
Click Add to Quote for price and delivery
Quantity: - +

Biochem/physiol Actions


TIMP-1 is glycoprotein that is over-expressed in the supernatant of tissue extracts of breast, gastric, colorectal, and hepatocellular carcinomas. It belongs to the family of “tissue inhibitors of metalloproteinases,” a group of proteins that help regulate bone turnover. TIMP-1 serum levels are significantly associated with HER2 extracellular domain (ECD)-positivity and poorer disease-free survival among primary breast cancer patients with HER2 overexpression. High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with bortezomib and/or IMiDs during their disease course.


General description


SILu™Prot TIMP1 is a recombinant, stable isotope-labeled human TIMP1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP1 in mass-spectrometry. SILu™Prot TIMP1 is a protein of 184 amino acids , with a calculated molecular mass of 20.7 kDa.


Legal Information


SILu is a trademark of Sigma-Aldrich Co. LLC


Physical form


Supplied as a lyophilized powder containing phosphate buffered saline.


Sequence


CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Quality Level200
ManufacturerSIGMA-ALDRICH
Storage Temp.−20°C
Suitabilitysuitable for mass spectrometry (standard)
Formlyophilized powder
Assay≥98% (SDS-PAGE)

There are no downloads for this product.