SILu(TM) Lite IFNG Interferon Gamma hum

Stock Code: 3587234
Manufacturer Part No: MSST0040-50UG
Order Now for 7 day delivery
Click Add to Quote for price and delivery
Quantity: - +

Biochem/physiol Actions


SILuLite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.


General description


Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.


Immunogen


QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG


Legal Information


SILu is a trademark of Sigma-Aldrich Co. LLC


Physical form


Lyophilized from a solution of phosphate buffered saline.

Quality Level200
ManufacturerSIGMA-ALDRICH
Formlyophilized powder
Assay≥98% (SDS-PAGE)

There are no downloads for this product.