Biochem/physiol Actions
SILu™Prot IGFBP7 is a recombinant, stable isotope-labeled human IGFBP7 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IGFBP7 in mass-spectrometry. SILu Prot IGFBP7 is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa.
General description
IGFBP7 regulates the availability of insulin-like growth factors (IGFs) in tissue, and modulates IGF binding to its receptors. IGFBP7 binds to IGF with high affinity. Several studies have shown the involvement of IGFBP7 in Acute Kidney Injury (AKI), where its levels can predict patients at risk for developing AKI. When combined with TIMP-2, the accuracy of AKI risk prediction is further increased. Urinary [TIMP-2]×[IGFBP7] test sufficiently detects patients with risk of AKI after major non-cardiac surgery. In addition, Urinary [TIMP-2]×[IGFBP7] serves as a sensitive and specific biomarker to predict AKI early after cardiac surgery and to predict renal recovery.
Immunogen
HHHHHHHHGGQSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.