Silu Lite B2M Beta 2 Microglobulin

Stock Code: 3587216
Manufacturer Part No: MSST0016-50UG
Order Now for 21 day delivery
Click Add to Quote for price and delivery
Quantity: - +

Biochem/physiol Actions


B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).


General description


SILu Lite B2M is a recombinant human protein expressed in human 293 cells. It is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa. SILu Lite B2M is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.Suggested Quantitative Analysis Parameters (MRM settings provided for three suggested peptides)


Legal Information


SILu is a trademark of Sigma-Aldrich Co. LLC


This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.


Physical form


Supplied as a lyophilized powder containing phosphate buffered saline.


Sequence


IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ

Quality Level200
ManufacturerSIGMA-ALDRICH
Storage Temp.−20°C
Suitabilitysuitable for mass spectrometry (internal calibrator)
Formlyophilized powder
Assay≥98% (SDS-PAGE)

There are no downloads for this product.