SILu(TM) Lite VEGFA Vascular endothelial growth factor A

SILu(TM) Lite VEGFA Vascular endothelial growth factor A

Stock Code: 3587206
Manufacturer Part No: MSST0006-50UG
Order Now for 7 day delivery
Click Add to Quote for price and delivery
Quantity: - +

Biochem/physiol Actions


VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.1 VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.2VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4


General description


SILu™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.Suggested Quantitative Analysis Parameters (MRM settings provided for three suggested peptides)


Legal Information


SILu is a trademark of Sigma-Aldrich Co. LLC


Physical form


Supplied as a lyophilized powder containing phosphate buffered saline


Sequence


APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

Quality Level200
ManufacturerSIGMA-ALDRICH
Technique(s)mass spectrometry (MS): suitable
Storage Temp.−20°C
Formlyophilized powder
Assay≥98% (SDS-PAGE)

There are no downloads for this product.