SILu(TM) Lite SigmaMAb Universal Antibody Standard human

SILu(TM) Lite SigmaMAb Universal Antibody Standard human

Stock Code: 3587193
Manufacturer Part No: MSQC4-1MG
Order Now for 21 day delivery
£394.18 (exc VAT) per 1MG
Quantity: - +

Analysis Note


SigmaMab Heavy ChainEVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKIGTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRWAPLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SigmaMab Light ChainQSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIYDATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGVVFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS


Also available as a stable isotope-labled product, Silu™Mab (Product Number MSQC3)


Package size based on protein content determined by A280


Application


SILu™ Lite SigmaMAb Universal Antibody Standard human has been used as a model system to investigate the quantitative relationship between gas-phase monoclonal antibody (mAb) unfolding and the discrete levels of mAb glycosylation.


Features and Benefits


Calculated molecular weight values of the SigmaMAb light chains, heavy chains, and intact protein, with the most abundant glycoforms, are as follows:Description / Composition / Modification / Average Mass (Da)Light chain, reduced / C1006H1555N267O333S7 / Pyroglutamic acid (Q) / 22942.2Heavy chain, reduced / C2181H3393N587O663S16 / (no modification) / 48957.8C2237H3485N591O702S16 / G0F / 50403.2C2243H3495N591O707S16 / G1F / 50565.3C2249H3505N591O712S16 / G2F / 50727.5Native intact mass, non-reduced / C6374H9864N1708O1992S46 / 2 X Pyroglutamic acid (Q) / 143767.7C6486H10048N1716O2070S46 / G0F+G0F / 146658.4C6492H10058N1716O2075S46 / G0F+G1F / 146820.6C6498H10068N1716O2080S46 / G1F+G1F / 146982.7C6504H10078N1716O2085S46 / G1F+G2F / 147144.8C6510H10088N1716O2090S46 / G2F+G2F / 147307.0


General description


SILU™ Lite SigmaMAb is a recombinant human monoclonal IgG1 lambda light antibody with a molecular mass of ~150 kDa expressed in CHO cells. It is designed for optimization of accurate intact mass analysis of monoclonal antibodies, biosimilars, and pharmaceutical products. Accurate intact mass analysis of such large biomolecules can provide comprehensive information about structural and post-translational modifications such as glycosylation. Other information such as heterogeneity, batch-to-batch variation, amino acid truncation, and N-terminal Lys processing, aggregation, and degradation can be determined

Quality Level200
ManufacturerSIGMA-ALDRICH
Storage Temp.−20°C

There are no downloads for this product.